PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf02842g00023.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family GATA
Protein Properties Length: 249aa    MW: 28117.7 Da    PI: 8.2142
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf02842g00023.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA611.5e-19181215135
                      GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                               C++Cg+ kTp+WR gp g+ktLCnaCG++y++ +l
  Niben101Scf02842g00023.1 181 CQHCGVDKTPQWRAGPMGPKTLCNACGVRYKSGRL 215
                               *******************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011412.057175211IPR000679Zinc finger, GATA-type
SMARTSM004012.9E-18175229IPR000679Zinc finger, GATA-type
SuperFamilySSF577169.98E-16177238No hitNo description
Gene3DG3DSA:3.30.50.105.5E-15178213IPR013088Zinc finger, NHR/GATA-type
CDDcd002029.75E-16180228No hitNo description
PROSITE patternPS003440181206IPR000679Zinc finger, GATA-type
PfamPF003202.1E-17181215IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 249 aa     Download sequence    Send to blast
MNMVEVLDSV TCFMVDDDIL NFSSSSFSSL DSSNNVTFLP DDHSRSFSES VEEELEWLSN  60
KDAFPAVEFD IFSENVSNAI FDHQSPVSVL ENGSSISTNN DSCNVNDKEN AFMIGCSSLQ  120
VPVNYPVRAR GKRRRRISFA DLTNERCVWG RKLKIKNNKQ EWELLSLPMT KAKRASIGRR  180
CQHCGVDKTP QWRAGPMGPK TLCNACGVRY KSGRLLPEYR PANSPTFSAD LHSNSHRKVL  240
EMRKQRIGI
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1131136KRRRRI
2132153RRRRISFADLTNERCVWGRKLK
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009758423.11e-150PREDICTED: GATA transcription factor 1
SwissprotQ8LAU99e-45GATA1_ARATH; GATA transcription factor 1
TrEMBLM1CLA01e-99M1CLA0_SOLTU; Uncharacterized protein
STRINGSolyc05g053500.2.15e-97(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA40762445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G24050.11e-42GATA transcription factor 1